PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr8P02290_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family MYB
Protein Properties Length: 421aa    MW: 46522.8 Da    PI: 9.0383
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr8P02290_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.56.2e-18129175148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            +g WT+eEd +lv++vkq+G + W+ I+r m  gR +kqc++rw+++l
  GSMUA_Achr8P02290_001 129 KGQWTAEEDSQLVRLVKQHGVRKWSYISRNMF-GRIGKQCRERWHNHL 175
                            799*****************************.*************97 PP

2Myb_DNA-binding574.4e-18184223445
                            S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
        Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                            WT+eE+ +l++a+ ++G++ W+ Iar+m  gR+++++k++w+
  GSMUA_Achr8P02290_001 184 WTEEEERQLIEAHMKFGNR-WAEIARHMS-GRSENSIKNHWN 223
                            *******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.172124179IPR017930Myb domain
SuperFamilySSF466895.62E-30128222IPR009057Homeodomain-like
SMARTSM007172.3E-15128177IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.8E-26130182IPR009057Homeodomain-like
CDDcd001671.46E-14132175No hitNo description
PfamPF139213.6E-17132192No hitNo description
SMARTSM007172.6E-16180228IPR001005SANT/Myb domain
PROSITE profilePS5129418.398180230IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.3E-21183228IPR009057Homeodomain-like
CDDcd001672.06E-14184226No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 421 aa     Download sequence    Send to blast
MDPAAARPHG FAGRTPPCSP VRPPPPLMSS ERFLSGYGQE EPCVFRGPAE KRAQDHGDPE  60
RLAGSLIGAI GITPNAGILS NASSFYGDLV SDSCKYEVVK KEDRGEEKQV RSSSWSSING  120
DATAAYVVKG QWTAEEDSQL VRLVKQHGVR KWSYISRNMF GRIGKQCRER WHNHLRPDIK  180
KAMWTEEEER QLIEAHMKFG NRWAEIARHM SGRSENSIKN HWNATKRKMN AKTSRRGNPD  240
NGGRCPPSVL QEYIQSKSTT LDFNKTCSTK TTPSSTSTQD STGSMEERLL HTRSAGGLQR  300
GETHGSFMHG SALNRLAFDA CQCMPTPCIG GGCYQPTAHS CSNNFSESSR STHLHSRNYA  360
SASSTDVIGM DNTWELLKAR ASSTSRNRDL DLVEMLSLQF SSSSQSSSSH SALHVANSKC  420
F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-411272305109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009419752.11e-118PREDICTED: uncharacterized protein LOC103999667
TrEMBLM0TLY10.0M0TLY1_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr8P02290_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58850.13e-55myb domain protein 119